Fc gamma RIII/CD16 Protein, Rhesus Macaque (His)

The Fc gamma RIII/CD16 protein is a receptor for IgG and is optimally activated upon binding to aggregated antigen-IgG complexes, initiating antibody-dependent cellular cytotoxicity (ADCC) and preventing inappropriate effector cell activation. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIII/CD16 Protein, Rhesus Macaque (His) is the recombinant Rhesus Macaque-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-His labeled tag. The total length of Fc gamma RIII/CD16 Protein, Rhesus Macaque (His) is 190 a.a., with molecular weight of ~32-41 KDa.

Fc gamma RIII/CD16 Protein serves as a receptor for the invariable Fc fragment of immunoglobulin gamma (IgG) and is optimally activated upon binding clustered antigen-IgG complexes displayed on cell surfaces, initiating the process of antibody-dependent cellular cytotoxicity (ADCC) leading to the lysis of antibody-coated cells. It does not bind free monomeric IgG, thereby avoiding inappropriate effector cell activation in the absence of an antigenic trigger. This receptor mediates IgG effector functions on natural killer (NK) cells, binding antigen-IgG complexes generated during infection to trigger NK cell-dependent cytokine production and degranulation, limiting viral load and propagation. Fc gamma RIII/CD16 is crucial in generating memory-like adaptive NK cells capable of producing high amounts of IFNG, efficiently eliminating virus-infected cells via ADCC, and regulating NK cell survival and proliferation by preventing NK cell progenitor apoptosis. As an Fc-binding subunit, it associates with CD247 and/or FCER1G adapters to form functional signaling complexes, initiating intracellular signaling cascades that drive NK cell activation. The ITAM-dependent signaling coupled with receptor phosphorylation by PKC mediates robust intracellular calcium flux, leading to the production of pro-inflammatory cytokines. Additionally, Fc gamma RIII/CD16 costimulates NK cells and triggers the lysis of target cells independently of IgG binding, mediating the antitumor activities of therapeutic antibodies. It also plays a role in enhanced ADCC in response to afucosylated IgGs. The protein forms a heterooligomeric complex with ITAM-containing signaling subunits, including homodimers of CD247 or FCER1G, or a heterodimer of CD247 and FCER1G, to constitute a functional receptor complex. Fc gamma RIII/CD16 interacts with the Fc region of antigen-complexed IgG, showing a preference for IgG1 and IgG3 isotypes. It further interacts with CD2, contributing to NK cell activation and cytotoxicity, and with S100A4, inhibiting PKC-dependent phosphorylation of FCGR3A.

Measured by its binding ability in a functional ELISA. Immobilized Rhesus CD16 at 10 μg/mL (100 μL/well) can bind Biotinylated Human lgG. The ED₅₀ for this effect is 0.2155 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Rhesus CD16 at 10 μg/mL (100 μL/well) can bind Biotinylated Human lgG. The ED₅₀ for this effect is 0.2155 μg/mL.

Rhesus Macaque

HEK293

C-His

A3RFZ7 (G17-G206)

720006  [NCBI]

GMRAEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPG

Approximately 32-41 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.