Fc gamma RIIIA/CD16a Protein, Rat (HEK293, C-His)

Fc γ RIIIA/CD16a is a receptor for the invariant Fc fragment of immunoglobulin γ (IgG). Fc γ RIIIA/CD16a regulates NK cell survival and proliferation and prevents NK cell progenitor cell apoptosis. Fc γ RIIIA/CD16a plays a role in mediating the anti-tumor activity of therapeutic antibodies by triggering TNFA-dependent ADCC, which promotes the entry of the virus into bone marrow cells during secondary infection and subsequent viral replication through antibody-dependent enhancement (ADE). Fc gamma RIIIA/CD16a Protein, Rat (HEK293, C-His) is the recombinant rat-derived Fc gamma RIIIA/CD16a, expressed by HEK293 , with C-His labeled tag. The total length of Fc gamma RIIIA/CD16a Protein, Rat (HEK293, C-His) is 179 a.a.,

The Fc γ RIIIA/CD16a protein is a receptor for the invariant Fc fragment of immunoglobulin γ (IgG) and is optimally activated upon binding to the aggregation antigen-igg complex displayed on the cell surface, initiating antibody-dependent cytotoxicity (ADCC). Fc γ RIIIA/CD16a mediates IgG effects on natural killer (NK) cells, binding to antigen-igg complexes produced during infection, triggering NK cell-dependent cytokine production and degranulation. Fc γ RIIIA/CD16a plays a crucial role in the generation of memory-like adaptive NK cells, regulating NK cell survival and proliferation, and preventing NK cell progenitor cell apoptosis. Fc γ RIIIA/CD16a plays a role in mediating the antitumor activity of therapeutic antibodies, triggering TNFA-dependent ADCC in IgG-coated tumor cells and enhancing ADCC in response to focused IgG. Fc γ RIIIA/CD16a is involved in pathogenesis through an antibody-dependent enhancement (ADE) mechanism that promotes the entry of the virus into bone marrow cells during secondary infection and subsequent viral replication^[1][2][3].

Measured by its binding ability in a functional ELISA. Immobilized Rat CD16a protein at 10 μg/mL (100 μL/well) can bind Human IgG1. The ED₅₀ for this effect is 93.49 ng/mL.

Rat

HEK293

C-His

XP_008767961.1 (L22-P200)

304966

LQKAVVILDPEWVRVLEEDCVILRCQGTFSPEDNSTKWFHNKSLISHQDANYVIQSARVKDSGMYRCQTAFSALSDPVQLDVHADWLLLQTTKRLFQEGDPIRLRCHSWRNTPVFKVTYLQNGKGKKYFHRNSELSISKATHADSGSYFCRGIIGRNNISSASLQISIGDPTSPSSFLP

Approximately 27-32 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.