1. Recombinant Proteins
  2. CD Antigens Fc Receptors
  3. Macrophage CD Proteins
  4. Fc alpha RI/CD89
  5. FCAR/CD89 Protein, Human (HEK293, His)

The FCAR/CD89 protein is crucial and can specifically bind to the Fc region of immunoglobulin α to promote the production of cytokines. FCAR/CD89 binds to the Fc epsilon RI gamma 2 receptor, induces gamma 2 tyrosine phosphorylation, and is complexly involved in signaling pathways and immune responses. FCAR/CD89 Protein, Human (HEK293, His) is the recombinant human-derived FCAR/CD89 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FCAR/CD89 protein is crucial and can specifically bind to the Fc region of immunoglobulin α to promote the production of cytokines. FCAR/CD89 binds to the Fc epsilon RI gamma 2 receptor, induces gamma 2 tyrosine phosphorylation, and is complexly involved in signaling pathways and immune responses. FCAR/CD89 Protein, Human (HEK293, His) is the recombinant human-derived FCAR/CD89 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The FCAR/CD89 protein plays a pivotal role as it specifically binds to the Fc region of immunoglobulins alpha, facilitating various functions such as cytokine production. In its association with the Fc epsilon RI gamma 2 receptor, FCAR/CD89 induces tyrosine phosphorylation of gamma 2, highlighting its involvement in intricate signaling pathways and immune responses. The interaction between FCAR/CD89 and immunoglobulins alpha underscores its significance in modulating immune processes and contributing to the regulation of cytokine production, emphasizing its multifaceted role in the immune system.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P24071-1 (Q22-N227)

Gene ID
Molecular Construction
N-term
FCAR (Q22-N227)
Accession # P24071-1
6*His
C-term
Synonyms
Immunoglobulin Alpha Fc Receptor; IgA Fc Receptor; CD89; FCAR
AA Sequence

QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN

Molecular Weight

Approximately 40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FCAR/CD89 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FCAR/CD89 Protein, Human (HEK293, His)
Cat. No.:
HY-P72657
Quantity:
MCE Japan Authorized Agent: