FCRL6 Protein, Human (His)

The FCRL6 protein acts as a receptor for MHC class II and interacts with HLA-DR when specific beta chains are associated. Although independent stimulation of FCRL6 does not promote cytokine production or cytotoxic activity, it exhibits tyrosine phosphorylation interactions with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. FCRL6 Protein, Human (His) is the recombinant human-derived FCRL6 protein, expressed by E. coli , with N-His labeled tag.

FCRL6 Protein acts as a receptor for MHC class II, as demonstrated by its interaction with HLA-DR when the alpha chain is associated with specific beta chains. However, when stimulated independently, FCRL6 does not contribute to cytokine production, cytotoxic granule release by NK cells, or cytotoxic CD8(+) T cells. Not functioning as an Fc receptor, FCRL6 exhibits interactions, particularly tyrosine phosphorylated interactions, with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. These associations highlight the potential regulatory role of FCRL6 in signaling pathways mediated by tyrosine phosphorylation events involving various cellular proteins.

Human

E. coli

N-His

Q6DN72-1 (L20-W307)

343413  [NCBI]

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Approximately 35.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.