FGF-1 Protein, Canine

The FGF-1 protein is critical in cellular regulation, coordinating key processes such as cell survival, division, angiogenesis, differentiation and migration. It exhibits potent mitogenic properties in vitro and serves as a ligand for FGFR1 and integrins. FGF-1 Protein, Canine is the recombinant canine-derived FGF-1 protein, expressed by E. coli , with tag free. The total length of FGF-1 Protein, Canine is 140 a.a., with molecular weight of ~16 kDa.

The FGF-1 protein plays a pivotal role in regulating important cellular processes such as cell survival, division, angiogenesis, differentiation, and migration. In vitro, it exhibits potent mitogenic properties and acts as a ligand for both FGFR1 and integrins. When heparin is present, FGF-1 binds to FGFR1, resulting in the dimerization and activation of FGFR1 through autophosphorylation on tyrosine residues. These phosphorylated residues serve as docking sites for interacting proteins, initiating various signaling cascades. FGF-1 also binds to integrins and forms a ternary complex with integrins and FGFR1, which is crucial for FGF-1 signaling.

Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED₅₀ for this effect is 0.2335 ng/mL, corresponding to a specific activity is 4.28×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED₅₀ for this effect is 0.2335 ng/mL, corresponding to a specific activity is 4.28×10⁶ units/mg.

Canine

E. coli

Tag Free

J9NTP4 (F16-D155)

607724  [NCBI]

FNLPPGNYMKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Approximately 16 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.