1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-17
  6. FGF-17 Protein, Mouse (His)

FGF-17 Protein, Mouse (His)

Cat. No.: HY-P72653
COA Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $32 In-stock
10 μg $90 In-stock
50 μg $250 In-stock
100 μg $400 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

FGF-17 Protein, Mouse (His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Biological Activity

Measured in a cell proliferation assay using NIH 3T3 mouse fibroblast cells. The ED50 for this effect is 61.38 ng/mL, in the presence of 10 µg/mL heparin, corresponding to a specific activity is 1.63×104 units/mg.

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

P63075 (T23-T216)

Gene ID

14171  [NCBI]

Molecular Construction
N-term
FGF-17 (T23-T216)
Accession # P63075
6*His
C-term
Synonyms
Fibroblast Growth Factor 17; FGF-17; FGF17
AA Sequence

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Weight

Approximately 24 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 1 M NaCl, pH 8.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-17 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-17 Protein, Mouse (His)
Cat. No.:
HY-P72653
Quantity:
MCE Japan Authorized Agent: