1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-18
  6. FGF-18 Protein, Human

FGF-18 Protein, Human

Cat. No.: HY-P7123
SDS COA Handling Instructions

FGF-18 Protein, Human is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $72 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FGF-18 Protein, Human is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.

Background

Fibroblast growth factor 18 (FGF18), a secreted heparin-binding polypeptide growth factor, is related to FGF8 and 175 and has been shown to have a number of functions in different organs. FGF18 is involved in cartilage growth and maturation and is implicated in the development of functional cartilage and bone tissue. It is also involved in processes within mature cartilage10-13 as well as being shown to have a role in enhancing regeneration and repair[1]. Fibroblast growth factor 18 (FGF18) acts as an important role in skeletal growth and limb development, potentially through the modulation of osteoblasts, chondrocytes, and osteoclasts[2].

Biological Activity

1.The ED50 is <10 ng/mL as measured by 3T3 cells, corresponding to a specific activity of > 1.0 × 105 units/mg.
2.Measured by its binding ability in a functional ELISA. Immobilized Human FGF18 at 10 μg/mL (100 μL/well) can bind Biotinylated Rat FGFR4 protein. The ED50 for this effect is 0.8084 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human FGF18 at 10 μg/mL (100 μL/well) can bind Biotinylated Rat FGFR4 protein. The ED50 for this effect is 0.8084 μg/mL.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

O76093 (A27-R199)

Gene ID
Molecular Construction
N-term
FGF-18 (A27-R199)
Accession # O76093
C-term
Synonyms
rHuFGF-18; zFGF5; FGF18
AA Sequence

AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR

Molecular Weight

Approximately 20.3 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

FGF-18 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-18 Protein, Human
Cat. No.:
HY-P7123
Quantity:
MCE Japan Authorized Agent: