FGF-18 Protein, Human

FGF-18 Protein, Human is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.

Fibroblast growth factor 18 (FGF18), a secreted heparin-binding polypeptide growth factor, is related to FGF8 and 175 and has been shown to have a number of functions in different organs. FGF18 is involved in cartilage growth and maturation and is implicated in the development of functional cartilage and bone tissue. It is also involved in processes within mature cartilage10-13 as well as being shown to have a role in enhancing regeneration and repair^[1]. Fibroblast growth factor 18 (FGF18) acts as an important role in skeletal growth and limb development, potentially through the modulation of osteoblasts, chondrocytes, and osteoclasts^[2].

1.The ED₅₀ is <10 ng/mL as measured by 3T3 cells, corresponding to a specific activity of > 1.0 × 10⁵ units/mg.
2.Measured by its binding ability in a functional ELISA. Immobilized Human FGF18 at 10 μg/mL (100 μL/well) can bind Biotinylated Rat FGFR4 protein. The ED₅₀ for this effect is 0.8084 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human FGF18 at 10 μg/mL (100 μL/well) can bind Biotinylated Rat FGFR4 protein. The ED₅₀ for this effect is 0.8084 μg/mL.

Human

E. coli

Tag Free

O76093 (A27-R199)

8817  [NCBI]

AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR

Approximately 20.3 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Barr L, et al. The effect of recombinant human fibroblast growth factor-18 on articular cartilage following single impact load. J Orthop Res. 2014 Jul;32(7):923-7.  [Content Brief]

  [2]. Chen T, et al. Fibroblast growth factor 18 promotes proliferation and migration of H460 cells via the ERK and p38 signaling pathways. Oncol Rep. 2017 Feb;37(2):1235-1242.  [Content Brief]