FGF-21 Protein, Mouse

FGF-21 Protein, Mouse emerges as a metabolic hormone involved in the regulation of glucose, lipid, bile acid, and phosphate metabolism.

Fibroblast growth factor (FGF) 21 is a member of the FGF superfamily. It is most closely related to FGF19 and FGF23, sharing 30–35% amino acid sequence homology. The FGF19 subfamily comprises FGF19, FGF21, and FGF23, and all three FGF19 subfamily members have recently emerged as metabolic hormones involved in the regulation of glucose, lipid, bile acid, and phosphate metabolism^[1]. FGF21 provides sustained glucose and lipid control, amelioration of insulin resistance, improvements in β-cell function and mass, and beneficial changes in other lipoprotein and cardiovascular risk factor profiles^[2].

1. The ED₅₀ is <0.5 μg/mL as measured by a cell proliferation assay using NIH-3T3 cells in the presence of 1.25 µg/mL mouse Klotho and 10.0 µg/mL heparin, corresponding to a specific activity of >2.0 × 10³ units/mg.
2. Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is ≤1.001 μg/mL in the presence of 1 μg/mL Recombinant Human Klotho beta, corresponding to a specific activity is ≥ 989.12 units/mg.

• 
  Measured in a cell proliferation assay using NIH‑3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 1.001 μg/mL in the presence of 1 μg/mL Recombinant Human Klotho beta, corresponding to a specific activity is 989.12 units/mg.

Mouse

E. coli

Tag Free

Q9JJN1 (A29-S210)

56636  [NCBI]

AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Approximately 20-23 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Xu J, et al. Fibroblast growth factor 21 reverses hepatic steatosis, increases energy expenditure, and improves insulin sensitivity in diet-induced obese mice. Diabetes. 2009 Jan;58(1):250-9.  [Content Brief]

  [2]. Coskun T, et al. Fibroblast growth factor 21 corrects obesity in mice. Endocrinology. 2008 Dec;149(12):6018-27.  [Content Brief]