FGF-22 Protein, Human (His-SUMO)

FGF-22 Protein, multifaceted in physiological processes, influences fasting response, glucose homeostasis, lipolysis, and lipogenesis.It stimulates in vitro cell proliferation and may contribute to hair development.Functionally, FGF-22 forms complexes with FGFR1 and FGFR2, integral to FGF signaling pathways.Interactions with FGFBP1 highlight its role in finely tuned regulatory networks governing cellular and metabolic activities.FGF-22 Protein, Human (His-SUMO) is the recombinant human-derived FGF-22 protein, expressed by E.coli , with N-SUMO, N-6*His labeled tag.

FGF-22, a multifaceted protein, is intricately involved in diverse physiological processes, including the fasting response, glucose homeostasis, lipolysis, and lipogenesis. Beyond its metabolic roles, FGF-22 exhibits the capacity to stimulate cell proliferation in vitro, highlighting its impact on cellular dynamics. Moreover, the protein may contribute to the intricate processes underlying hair development. Functionally, FGF-22 engages in significant molecular interactions, forming complexes with FGFR1 and FGFR2, essential players in FGF signaling pathways. Additionally, it interacts with FGFBP1, further emphasizing its involvement in finely tuned regulatory networks that govern various cellular and metabolic activities.

Human

E. coli

N-SUMO;N-6*His

Q9HCT0 (T23-S170)

27006  [NCBI]

TPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS

30.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.