FGF-23 Protein, Mouse (HEK293, His)

FGF-23 protein is a key regulator that maintains phosphate homeostasis by inhibiting tubular phosphate transport and reducing SLC34A1 levels. It directly inhibits PTH secretion, regulates vitamin D metabolism, and negatively affects osteoblast differentiation and matrix mineralization. FGF-23 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGF-23 protein, expressed by HEK293 , with C-6*His labeled tag and R179Q mutation. The total length of FGF-23 Protein, Mouse (HEK293, His) is 227 a.a., with molecular weight of ~30-32 kDa.

FGF-23 protein serves as a key regulator in maintaining phosphate homeostasis by inhibiting renal tubular phosphate transport, primarily through the reduction of SLC34A1 levels. Additionally, it acts directly on the parathyroid to suppress PTH secretion and plays a pivotal role in vitamin-D metabolism regulation. FGF-23 serves as a negative regulator of osteoblast differentiation and matrix mineralization. Furthermore, it exhibits the ability to up-regulate EGR1 expression in the presence of KL and interacts with various fibroblast growth factor receptors (FGFRs), including FGFR1, FGFR2, FGFR3, and FGFR4. The interaction between FGF-23 and FGFRs is facilitated by KL and heparan sulfate glycosaminoglycans, acting as coreceptors.

Mouse

HEK293

C-6*His

Q9EPC2 (Y25-V251, R179Q)

64654

YPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFRQWTLENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTQSAEDPPERDPLNVLKPRPRATPVPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARGGAGGADRCRPFPRFV

Approximately 30-32 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU/μg, determined by LAL method.