FGF-23 Protein, Mouse (HEK293, His)

FGF-23 protein is a key regulator that maintains phosphate homeostasis by inhibiting tubular phosphate transport and reducing SLC34A1 levels. It directly inhibits PTH secretion, regulates vitamin D metabolism, and negatively affects osteoblast differentiation and matrix mineralization. FGF-23 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGF-23 protein, expressed by HEK293 , with C-6*His labeled tag and R179Q mutation. The total length of FGF-23 Protein, Mouse (HEK293, His) is 227 a.a., with molecular weight of ~30-32 kDa.

FGF-23 protein serves as a key regulator in maintaining phosphate homeostasis by inhibiting renal tubular phosphate transport, primarily through the reduction of SLC34A1 levels. Additionally, it acts directly on the parathyroid to suppress PTH secretion and plays a pivotal role in vitamin-D metabolism regulation. FGF-23 serves as a negative regulator of osteoblast differentiation and matrix mineralization. Furthermore, it exhibits the ability to up-regulate EGR1 expression in the presence of KL and interacts with various fibroblast growth factor receptors (FGFRs), including FGFR1, FGFR2, FGFR3, and FGFR4. The interaction between FGF-23 and FGFRs is facilitated by KL and heparan sulfate glycosaminoglycans, acting as coreceptors.

Determined by its ability to stimulate the proliferation of murine NIH-3T3 cells. The ED₅₀ for this effect is 0.2468 μg/mL in the presence of 1 μg/mL murine Klotho and 100μg/mL heparin, corresponding to a specific activity is 4.051×10³units/mg.

Mouse

HEK293

C-6*His

Q9EPC2 (Y25-V251, R179Q)

64654

YPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFRQWTLENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTQSAEDPPERDPLNVLKPRPRATPVPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARGGAGGADRCRPFPRFV

Approximately 30-32 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM MOPS, 150 mM NaCl, pH 7.4, 1 mM EDTA, 1 mM DTT, 8% trehalose.

<0.1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.