1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-4
  6. FGF-4 Protein, Human

FGF-4 Protein, Human is a member of the FGF family that transforms 3T3 cells with high efficiency, stimulates endothelial cell proliferation, migration, and protease production, and shows angiogenic activity.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

FGF-4 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FGF-4 Protein, Human is a member of the FGF family that transforms 3T3 cells with high efficiency, stimulates endothelial cell proliferation, migration, and protease production, and shows angiogenic activity.

Background

Fibroblast Growth Factor 4 (EGF 4) is a member of the FGF family that transforms 3T3 cells with high efficiency, stimulates endothelial cell proliferation, migration, and protease production, and shows angiogenic activity[1].

Biological Activity

The ED50 is ≤1.5 ng/mL as measured by 3T3 cells, corresponding to a specific activity of ≥6.67 × 105 units/mg.

  • Measured in a cell proliferation assay using NIH/3T3 cells. The ED50for this effect is 1.38 ng/mL, corresponding to a specific activity is 7.246×105 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P08620-1 (A31-L206)

Gene ID
Molecular Construction
N-term
FGF-4 (A31-L206)
Accession # P08620
C-term
Synonyms
rHuFGF-4; HBGF-4; HST; HST-1; HSTF1
AA Sequence

APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Weight

Approximately 19.4 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 750 mM NaCl, pH 7.5 or 50 mM HEPES, 750 mM NaCl, pH 7.5, 8% trehalose.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

FGF-4 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-4 Protein, Human
Cat. No.:
HY-P7014
Quantity:
MCE Japan Authorized Agent: