FGF-4 Protein, Human

FGF-4 Protein, Human is a member of the FGF family that transforms 3T3 cells with high efficiency, stimulates endothelial cell proliferation, migration, and protease production, and shows angiogenic activity.

Fibroblast Growth Factor 4 (EGF 4) is a member of the FGF family that transforms 3T3 cells with high efficiency, stimulates endothelial cell proliferation, migration, and protease production, and shows angiogenic activity^[1].

The ED₅₀ is ≤1.5 ng/mL as measured by 3T3 cells, corresponding to a specific activity of ≥6.67 × 10⁵ units/mg.

• 
  Measured in a cell proliferation assay using NIH/3T3 cells. The ED₅₀for this effect is 1.38 ng/mL, corresponding to a specific activity is 7.246×10⁵ units/mg.

Human

E. coli

Tag Free

P08620-1 (A31-L206)

2249  [NCBI]

APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Approximately 19.4 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 750 mM NaCl, pH 7.5 or 50 mM HEPES, 750 mM NaCl, pH 7.5, 8% trehalose.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Dell'Era P, et al. Paracrine and autocrine effects of fibroblast growth factor-4 in endothelial cells. Oncogene. 2001 May 10;20(21):2655-63.  [Content Brief]