FGF-8f Protein, Human

FGF-8f Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

Fibroblast Growth Factor 8 is an essential factor during embryonic development, overexpressed in several tumor types. Fibroblast Growth Factor 8 stimulates anti-apoptotic pathways and prevents tumor cell death^[1].

The ED₅₀ is <50 ng/mL as measured by 3T3 cells, corresponding to a specific activity of >2 × 10⁴ units/mg.

Human

E. coli

Tag Free

P55075-4 (Q23-R244)

2253  [NCBI]

MQEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Approximately 25.5 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Harpain F, et al. FGF8 induces therapy resistance in neoadjuvantly radiated rectal cancer. J Cancer Res Clin Oncol. 2019 Jan;145(1):77-86.  [Content Brief]