FGF basic Protein, Salmon

FGF basic Protein, Salmon is the recombinant FGF-basic protein, expressed by E. coli , with tag free.

Measure by its ability by a dose-response proliferation assay using murine Balb/c 3T3 cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of this protein is > 1.0 × 10⁶ IU/mg. (It is recommended to experimentally determine the optimal concentration for each specific application by performing a dose response assay.)

Others

E. coli

Tag Free

XP_035600424.1 (M1-R155)

118363560

MATGEITTLPATPEDGGSGGFPPGNFKEPKRLYCKNGGYFLRINSNGSVDGIREKNDPHIKLQLQATSVGEVVIKGVSANRYLAMNGDGRLFGTRRTTDECYFMERLESNNYNTYRSRKYPDMYVALKRTGQHKSGSKTGPGQKAILFLPMSARR

Approximately 20 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 7.8 mM Na₂HPO₄, 1.5 mM KH₂PO₄, 2.7 mM KCl, 500 mM NaCl.

< 0.2 EU/μg of protein by gel clotting method

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.