1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-2/bFGF
  6. FGF basic Protein, Salmon

FGF basic Protein, Salmon is the recombinant FGF-basic protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF basic Protein, Salmon is the recombinant FGF-basic protein, expressed by E. coli , with tag free.

Biological Activity

Measure by its ability by a dose-response proliferation assay using murine Balb/c 3T3 cells. The ED50 for this effect is <1 ng/mL. The specific activity of this protein is > 1.0 × 106 IU/mg. (It is recommended to experimentally determine the optimal concentration for each specific application by performing a dose response assay.)

Species

Others

Source

E. coli

Tag

Tag Free

Accession

XP_035600424.1 (M1-R155)

Gene ID

118363560

Molecular Construction
N-term
FGF basic (M1-R155)
Accession # XP_035600424.1
C-term
Synonyms
Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2; FGF2; FGFB
AA Sequence

MATGEITTLPATPEDGGSGGFPPGNFKEPKRLYCKNGGYFLRINSNGSVDGIREKNDPHIKLQLQATSVGEVVIKGVSANRYLAMNGDGRLFGTRRTTDECYFMERLESNNYNTYRSRKYPDMYVALKRTGQHKSGSKTGPGQKAILFLPMSARR

Molecular Weight

Approximately 20 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 7.8 mM Na2HPO4, 1.5 mM KH2PO4, 2.7 mM KCl, 500 mM NaCl.

Endotoxin Level

< 0.2 EU/μg of protein by gel clotting method

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF basic Protein, Salmon Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF basic Protein, Salmon
Cat. No.:
HY-P701238
Quantity:
MCE Japan Authorized Agent: