FGF-18 Protein, Human (HEK293, His)

FGF-18 Protein intricately regulates cell proliferation, differentiation, and migration, crucial in normal ossification and bone development for skeletal maturation. It stimulates hepatic and intestinal proliferation, showcasing versatile functions. Interactions with FGFR3 and FGFR4 underscore FGF-18 Protein's significance in modulating intricate signaling pathways for fundamental tissue development and homeostasis. FGF-18 Protein, Human (HEK293, His) is the recombinant human-derived FGF-18 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FGF-18 Protein, Human (HEK293, His) is 180 a.a., with molecular weight of ~32 kDa.

FGF-18 Protein assumes a pivotal role in intricately regulating cell proliferation, differentiation, and migration. Its indispensability extends to the orchestration of normal ossification and bone development, emphasizing its crucial involvement in skeletal maturation. Additionally, FGF-18 Protein demonstrates the ability to stimulate hepatic and intestinal proliferation, highlighting its versatile functions across different tissues. The mediation of these cellular processes is facilitated through interactions with FGFR3 and FGFR4, underscoring the significance of FGF-18 Protein in modulating intricate signaling pathways that contribute to fundamental processes in tissue development and homeostasis.

Measured by its binding ability in a functional ELISA. Immobilized FGF18 Protein, Human (HEK293, His) at 10 μg/mL (100 μl/well) can bind rat FGFR4 and the EC₅₀ is 1.17 μg/mL.

Human

HEK293

C-6*His

O76093 (E28-A207)

8817  [NCBI]

MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA

Approximately 32 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.