1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-2/bFGF
  6. FGF basic/bFGF protein, Bovine (His)

FGF2 protein is a multifunctional ligand that can bind to FGFR1, FGFR2, FGFR3 and FGFR4. It is also a key integrin ligand for FGF2 signal transduction and has an important interaction with the integrin ITGAV:ITGB3. FGF2 plays a critical role in cell survival, division, differentiation, and migration, serves as a potent mitogen, and induces angiogenesis. FFGF basic/bFGF protein, Bovine (His)) is the recombinant bovine-derived FGF2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE FGF basic/bFGF protein, Bovine (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF2 protein is a multifunctional ligand that can bind to FGFR1, FGFR2, FGFR3 and FGFR4. It is also a key integrin ligand for FGF2 signal transduction and has an important interaction with the integrin ITGAV:ITGB3. FGF2 plays a critical role in cell survival, division, differentiation, and migration, serves as a potent mitogen, and induces angiogenesis. FFGF basic/bFGF protein, Bovine (His)) is the recombinant bovine-derived FGF2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

FGF2 Protein serves as a versatile ligand, binding to FGFR1, FGFR2, FGFR3, and FGFR4, and also functions as an integrin ligand crucial for FGF2 signaling. The interaction with integrin ITGAV:ITGB3 is essential for this signaling pathway. FGF2 plays a pivotal role in regulating cell survival, cell division, cell differentiation, and cell migration. Additionally, it acts as a potent mitogen in vitro and has the capability to induce angiogenesis. FGF2's influence extends to promoting retinal lens fiber differentiation through the phosphorylation of ERK1/2. Existing as a monomer or homodimer, FGF2 interacts with its receptors FGFR1, FGFR2, FGFR3, and FGFR4, and its affinity for these receptors is enhanced by heparan sulfate glycosaminoglycans. Furthermore, FGF2 forms complexes with other proteins such as CSPG4, FGFBP1, TEC, and FGFBP3, contributing to its diverse cellular functions. The interaction with integrin ITGAV:ITGB3 is indispensable for FGF2 signaling, and additional interactions with SNORC and glypican GPC3 further illustrate the intricate network of FGF2-associated proteins.

Species

Bovine

Source

E. coli

Tag

N-6*His

Accession

P03969 (P10-S155)

Gene ID

281161

Molecular Construction
N-term
6*His
FGF basic/bFGF (P10-S155)
Accession # P03969
C-term
Synonyms
Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; Fgf2; Fgf-2
AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Molecular Weight

20.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF basic/bFGF protein, Bovine (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF basic/bFGF protein, Bovine (His)
Cat. No.:
HY-P700476
Quantity:
MCE Japan Authorized Agent: