FGF basic/bFGF protein, Bovine (P. pastoris, N-His)

FGF2 protein is a multifunctional ligand that can bind to FGFR1, FGFR2, FGFR3 and FGFR4. It is also a key integrin ligand for FGF2 signal transduction and has an important interaction with the integrin ITGAV:ITGB3. FGF2 plays a critical role in cell survival, division, differentiation, and migration, serves as a potent mitogen, and induces angiogenesis. FGF basic/bFGF protein, Bovine (P. pastoris, N-His) is the recombinant bovine-derived FGF2 protein, expressed by P. pastoris , with N-6*His labeled tag.

FGF2 Protein serves as a versatile ligand, binding to FGFR1, FGFR2, FGFR3, and FGFR4, and also functions as an integrin ligand crucial for FGF2 signaling. The interaction with integrin ITGAV:ITGB3 is essential for this signaling pathway. FGF2 plays a pivotal role in regulating cell survival, cell division, cell differentiation, and cell migration. Additionally, it acts as a potent mitogen in vitro and has the capability to induce angiogenesis. FGF2's influence extends to promoting retinal lens fiber differentiation through the phosphorylation of ERK1/2. Existing as a monomer or homodimer, FGF2 interacts with its receptors FGFR1, FGFR2, FGFR3, and FGFR4, and its affinity for these receptors is enhanced by heparan sulfate glycosaminoglycans. Furthermore, FGF2 forms complexes with other proteins such as CSPG4, FGFBP1, TEC, and FGFBP3, contributing to its diverse cellular functions. The interaction with integrin ITGAV:ITGB3 is indispensable for FGF2 signaling, and additional interactions with SNORC and glypican GPC3 further illustrate the intricate network of FGF2-associated proteins.

Bovine

P. pastoris

N-6*His

P03969 (P10-S155)

281161

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

18.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.