1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-2/bFGF
  6. FGF2 Protein, Chicken (His)

FGF2 Protein acts as a ligand for FGFR1-4 and an integrin ligand for FGF2 signaling. It regulates cell survival, division, differentiation, and migration. FGF2 Protein is a strong mitogen and can induce angiogenesis. FGF2 Protein, Chicken (His) is the recombinant FGF2 protein, expressed by E. coli , with C-6*His labeled tag. The total length of FGF2 Protein, Chicken (His) is 146 a.a., with molecular weight of 27 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE FGF2 Protein, Chicken (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF2 Protein acts as a ligand for FGFR1-4 and an integrin ligand for FGF2 signaling. It regulates cell survival, division, differentiation, and migration. FGF2 Protein is a strong mitogen and can induce angiogenesis. FGF2 Protein, Chicken (His) is the recombinant FGF2 protein, expressed by E. coli , with C-6*His labeled tag. The total length of FGF2 Protein, Chicken (His) is 146 a.a., with molecular weight of 27 kDa.

Background

The FGF2 protein serves as a ligand for FGFR1, FGFR2, FGFR3, and FGFR4, as well as an integrin ligand necessary for FGF2 signaling. It plays a crucial role in regulating cell survival, division, differentiation, and migration. Additionally, FGF2 functions as a potent mitogen in vitro and has the ability to induce angiogenesis.

Species

Others

Source

E. coli

Tag

C-6*His

Accession

P48800 (P13-S158)

Gene ID

396413  [NCBI]

Molecular Construction
N-term
FGF2 (P13-S158)
Accession # P48800
6*His
C-term
Synonyms
Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; Fgf2; Fgf-2
AA Sequence

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Molecular Weight

27 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF2 Protein, Chicken (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF2 Protein, Chicken (His)
Cat. No.:
HY-P700630
Quantity:
MCE Japan Authorized Agent: