FGF basic/bFGF Protein, Human (P. pastoris, N-His)

FGF basic, or bFGF (fibroblast growth factor basic), initiates at an alternative CUG codon, marking a distinctive feature in translational initiation. This alternative start codon plays a pivotal role in regulating the expression and functional properties of FGF basic. FGF basic/bFGF Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGF basic/bFGF protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of FGF basic/bFGF Protein, Human (P. pastoris, N-His) is 146 a.a., with molecular weight of 17.9 kDa.

Initiation of FGF basic, also known as bFGF (fibroblast growth factor basic), occurs at an alternative CUG codon. This alternative start codon represents a distinctive feature in the translational initiation of the protein, contributing to the unique regulatory mechanisms governing the expression and functional properties of FGF basic.

Human

P. pastoris

N-6*His

P09038-4 (P143-S288)

2247  [NCBI]

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

17.9-20 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.