1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins Enzymes & Regulators
  3. FGF Family Stem Cell CD Proteins Epithelial cell CD Proteins Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. FGFR-3 FGFR
  5. FGFR-3
  6. FGFR-3 Protein, Human (P. pastoris, N-His)

FGFR-3 Protein, Human (P. pastoris, N-His)

Cat. No.: HY-P700484
Handling Instructions

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGFR-3 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGFR-3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

FGFR-3 protein, a tyrosine-protein kinase, functions as a cell-surface receptor for fibroblast growth factors, playing a vital role in the regulation of cell proliferation, differentiation, and apoptosis. Its significance is particularly notable in the regulation of chondrocyte differentiation, proliferation, and apoptosis, contributing to normal skeleton development. Additionally, FGFR-3 plays a crucial role in both osteogenesis and postnatal bone mineralization by osteoblasts, while also promoting apoptosis in chondrocytes. Beyond its role in normal development, FGFR-3 is involved in inner ear development and has implications in the regulation of vitamin D metabolism. Upon ligand binding, FGFR-3 activates several signaling cascades, including the phosphorylation of PLCG1, CBL, and FRS2. This activation leads to the production of cellular signaling molecules such as diacylglycerol and inositol 1,4,5-trisphosphate. Furthermore, phosphorylation of FRS2 triggers the recruitment of GRB2, GAB1, PIK3R1, and SOS1, mediating the activation of RAS, MAPK1/ERK2, MAPK3/ERK1, the MAP kinase signaling pathway, and the AKT1 signaling pathway. Mutations leading to constitutive kinase activation or impairing normal FGFR3 maturation, internalization, and degradation result in aberrant signaling. Overexpression or constitutive activation of FGFR3 promotes the activation of PTPN11/SHP2, STAT1, STAT5A, and STAT5B. Additionally, the secreted isoform 3 retains its capacity to bind FGF1 and FGF2, potentially interfering with FGF signaling.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

P22607-1 (R397-T806)

Gene ID
Molecular Construction
N-term
6*His
FGFR-3 (R397-T806)
Accession # P22607-1
C-term
Synonyms
Fibroblast growth factor receptor 3; FGFR-3; CD333; Mfr3; Sam3
AA Sequence

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Molecular Weight

47.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FGFR-3 Protein, Human (P. pastoris, N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGFR-3 Protein, Human (P. pastoris, N-His)
Cat. No.:
HY-P700484
Quantity:
MCE Japan Authorized Agent: