FGFR-1 alpha (IIIb) Protein, Human (HEK293, His)

FGFR-1 alpha, a conserved member of the FGFR family, binds acidic and basic fibroblast growth factors, influencing mitogenesis and differentiation. Mutations in FGFR1 cause syndromes and disorders. It exhibits ubiquitous expression, with notable levels in ovary (RPKM 21.8), fat (RPKM 21.4), and 25 other tissues. Alternatively spliced variants contribute to its functional diversity. FGFR-1 alpha (IIIb) Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived FGFR-1 alpha, expressed by HEK293 , with C-His, C-10*His labeled tag. FGFR-1 alpha (IIIb) Protein, Human (HEK293, His), has molecular weight of 60-90 kDa.

Fibroblast Growth Factor Receptor 1 alpha (FGFR1), a member of the FGFR family, shares a highly conserved amino acid sequence with other family members and exhibits varying ligand affinities and tissue distributions. Comprising three immunoglobulin-like domains in its extracellular region, a single membrane-spanning segment, and a cytoplasmic tyrosine kinase domain, FGFR1 plays a pivotal role in transducing signals initiated by fibroblast growth factors. It binds both acidic and basic fibroblast growth factors, influencing mitogenesis and differentiation, particularly in limb induction. Mutations in FGFR1 have been linked to several syndromes, including Pfeiffer syndrome, Jackson-Weiss syndrome, and Kallmann syndrome 2, as well as disorders like osteoglophonic dysplasia. Chromosomal aberrations involving this gene are associated with stem cell myeloproliferative disorder and stem cell leukemia lymphoma syndrome. Various alternatively spliced variants, encoding distinct protein isoforms, have been identified, contributing to the functional diversity of FGFR1. The gene exhibits ubiquitous expression across tissues, with notable expression levels in ovary (RPKM 21.8), fat (RPKM 21.4), and 25 other tissues.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-His

NP_056934 (R22-K310&A359-E374)&AAB19502 (H1-P47)

2260  [NCBI]

A1:
RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILK
A2:
ALEERPAVMTSPLYLE
A3:
HSGINSSDAEVLTLFNVTEAQSGEYVCKVSNYIGEANQSAWLTVTRP

60-90 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.