FGFR-3 Protein, Mouse (HEK293, His)

The FGFR-3 protein is a tyrosine protein kinase that serves as a cell surface receptor for fibroblast growth factors and controls cellular processes, including proliferation, differentiation, and apoptosis. It is essential for chondrocyte differentiation, proliferation, apoptosis and normal bone development functions. FGFR-3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293 , with C-His labeled tag. The total length of FGFR-3 Protein, Mouse (HEK293, His) is 347 a.a., with molecular weight of 60-90 kDa.

FGFR-3 protein is a tyrosine-protein kinase that acts as a cell-surface receptor for fibroblast growth factors and is crucial for regulating cell proliferation, differentiation, and apoptosis. It plays a vital role in chondrocyte differentiation, proliferation, and apoptosis, as well as in normal skeleton development. FGFR-3 also regulates osteogenesis and postnatal bone mineralization in osteoblasts. It can promote apoptosis in chondrocytes but has also been implicated in cancer cell proliferation. Additionally, FGFR-3 is essential for the development of the inner ear and phosphorylates PLCG1, CBL, and FRS2. Ligand binding to FGFR-3 triggers various signaling cascades, including the production of diacylglycerol and inositol 1,4,5-trisphosphate through activation of PLCG1. Phosphorylation of FRS2 leads to the recruitment of GRB2, GAB1, PIK3R1, and SOS1, ultimately activating the RAS, MAPK1/ERK2, MAPK3/ERK1, and AKT1 signaling pathways. FGFR-3 also plays a role in vitamin D metabolism regulation. Aberrant signaling occurs when mutations result in constitutive kinase activation or impair normal FGFR3 maturation, internalization, and degradation. Overexpression or constitutive activation of FGFR-3 promotes the activation of STAT1, STAT5A, and STAT5B. Furthermore, FGFR-3 is involved in postnatal lung development.

Immobilized FGF basic at 5 µg/mL (100 µL/well) can bind Biotinylated FGFR-3. The ED₅₀ for this effect is 50.77 ng/mL.

• 
  Immobilized FGF basic at 5 µg/mL (100 µL/well) can bind Biotinylated FGF R3. The ED₅₀ for this effect is 50.77 ng/mL.

Mouse

HEK293

C-His

Q61851 (E21-Y367)

14184  [NCBI]

EPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVY

60-90 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.