FGL1 Protein, Human (HEK293, mFc, solution)

FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, mFc, solution) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of FGL1 Protein, Human (HEK293, mFc, solution) is 290 a.a., with molecular weight of 60-65 kDa.

FGL1 protein functions as an immune suppressive molecule, exerting inhibitory effects on antigen-specific T-cell activation by serving as a major ligand for LAG3. It plays a pivotal role in mediating LAG3's T-cell inhibitory function independently of MHC class II (MHC-II) binding. Beyond its immune-regulatory role, FGL1 is secreted by hepatocytes, contributing to their growth. Existing as a homodimer, FGL1 interacts with LAG3 through its Fibrinogen C-terminal domain, specifically binding to LAG3's Ig-like domains 1 and 2. This molecular interaction, detailed in studies, underscores the significance of FGL1 in modulating immune responses and hepatocyte growth, highlighting its potential as a key player in the regulation of T-cell activation and hepatic functions.

Human

HEK293

C-mFc

Q08830 (L23-I312)

2267  [NCBI]

LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

60-65 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.