FIBP Protein, Human

FIBP is an intracellular chaperone of acidic fibroblast growth factor (aFGF) and mediates the mitogenic effects of aFGF, affecting cell types through mitosis and inducing morphological changes and differentiation. This gene expresses two isoforms, showing potential functional diversity. FIBP Protein, Human is the recombinant human-derived FIBP protein, expressed by E. coli , with tag free. The total length of FIBP Protein, Human is 357 a.a., with molecular weight of 40-50 kDa.

The FIBP Protein plays a pivotal role as an intracellular binding partner for acidic fibroblast growth factor (aFGF), a mitogen with broad-ranging effects on various cell types, stimulating mitogenesis and inducing morphological changes and differentiation. FIBP's selective binding to aFGF suggests its potential involvement in mediating the mitogenic actions of aFGF within cells. This gene exhibits two transcript variants encoding different isoforms, highlighting the potential diversity in its functional roles. FIBP demonstrates ubiquitous expression, with prominent levels detected in the testis (RPKM 27.1), brain (RPKM 21.5), and 25 other tissues. Its widespread presence underscores its likely participation in diverse cellular processes across multiple organs.

Human

E. coli

Tag Free

O43427-2/NP_004205.2 (M1-D357)

9158  [NCBI]

MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD

40-50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.