Fibronectin Protein, Human (Biotinylated, His-Avi)

Fibronectin binds collagen, fibrin, heparin, DNA, and actin. It is involved in cell adhesion, motility, opsonization, wound healing and maintenance of cell shape. Fibronectin Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived Fibronectin protein, expressed by E. coli , with N-Avi, N-6*His labeled tag. The total length of Fibronectin Protein, Human (Biotinylated, His-Avi) is 91 a.a., with molecular weight of ~13.0 kDa.

Fibronectin, a versatile glycoprotein, plays a crucial role in cellular interactions by binding to various compounds such as collagen, fibrin, heparin, DNA, and actin. Its involvement in cell adhesion, motility, opsonization, wound healing, and maintenance of cell shape underscores its significance in fundamental cellular processes. Fibronectin also contributes to osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization, and regulates the deposition of type I collagen by osteoblasts. Acting as a ligand for the LILRB4 receptor, Fibronectin inhibits FCGR1A/CD64-mediated monocyte activation. Moreover, Fibronectin's ability to induce fibril formation, as observed in the fibronectin polymer named superfibronectin, imparts enhanced adhesive properties. Notably, both anastellin and superfibronectin exhibit inhibitory effects on tumor growth, angiogenesis, and metastasis, with anastellin activating p38 MAPK and inhibiting lysophospholipid signaling. The multifaceted functions of Fibronectin underscore its pivotal role in cellular dynamics and its potential as a target for therapeutic interventions in various pathological conditions.

Human

E. coli

N-Avi;N-6*His

P02751-15 (E1266-T1356)

2335  [NCBI]

EVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFT

Approximately 13.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.