FimH Protein, E.coli (P.pastoris, His)

FimH Protein, pivotal in regulating length, mediates adhesion for type 1 fimbriae without being essential for fimbriae production. Positioned laterally in the fimbriae structure, FimH primarily binds to D-mannose. FimH integration into fimbriae involves collaborative action with FimF and FimG, emphasizing the coordinated molecular interplay essential for type 1 fimbriae assembly and function. FimH Protein, E.coli (P.pastoris, His) is the recombinant Virus-derived FimH protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of FimH Protein, E.coli (P.pastoris, His) is 279 a.a., with molecular weight (glycosylation form) of ~38 kDa.

FimH protein plays a pivotal role in the intricate regulation of length and serves as a mediator for the adhesion process associated with type 1 fimbriae, albeit not indispensable for fimbriae production. This adhesin assumes a lateral position at intervals within the type 1 fimbriae structure and is primarily responsible for binding to D-mannose. The integration of FimH into the fimbriae structure necessitates the collaborative action of FimF and FimG, emphasizing the coordinated molecular interplay required for the assembly and functional manifestation of type 1 fimbriae.

Virus

P. pastoris

N-6*His

P08191 (F22-Q300)

948847  [NCBI]

FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ

Approximately 38 kDa.The reducing (R) protein migratesas 38 kDa in SDS-PAGE may be due to glycosylation.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.