FIS1 Protein, Human (His)

The FIS1 protein is essential for mitochondrial network fragmentation and perinuclear clustering. Although FIS1 plays a minor role in recruiting DNM1L to the mitochondrial surface, it is associated with fission. FIS1 Protein, Human (His) is the recombinant human-derived FIS1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of FIS1 Protein, Human (His) is 122 a.a., with molecular weight of ~15.0 kDa.

The FIS1 Protein plays a crucial role in the fragmentation of the mitochondrial network, contributing to its perinuclear clustering. While it has a minor role in recruiting and associating with the fission mediator dynamin-related protein 1 (DNM1L) on the mitochondrial surface, FIS1 is implicated in mitochondrial fission. Notably, it may not be essential for the assembly of functional fission complexes and subsequent membrane scission events. Beyond its involvement in mitochondrial dynamics, FIS1 also mediates peroxisomal fission, particularly when the outcomes of fission are directed towards mitochondrial homeostasis, mitophagy, or apoptosis. The protein can induce the release of cytochrome c from the mitochondrion to the cytosol, ultimately triggering apoptosis. Interactions with DNM1L/DLP1, MARCHF5, MIEF1, and PEX11A, PEX11B, PEX11G highlight the intricate network of associations that contribute to FIS1's multifaceted role at the interface of mitochondrial and peroxisomal dynamics.

Human

E. coli

C-6*His

Q9Y3D6 (M1-G122)

51024  [NCBI]

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG

Approximately 15.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.