1. Recombinant Proteins
  2. Others
  3. FIS1 Protein, Human (His)

The FIS1 protein is essential for mitochondrial network fragmentation and perinuclear clustering. Although FIS1 plays a minor role in recruiting DNM1L to the mitochondrial surface, it is associated with fission. FIS1 Protein, Human (His) is the recombinant human-derived FIS1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of FIS1 Protein, Human (His) is 122 a.a., with molecular weight of ~15.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FIS1 protein is essential for mitochondrial network fragmentation and perinuclear clustering. Although FIS1 plays a minor role in recruiting DNM1L to the mitochondrial surface, it is associated with fission. FIS1 Protein, Human (His) is the recombinant human-derived FIS1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of FIS1 Protein, Human (His) is 122 a.a., with molecular weight of ~15.0 kDa.

Background

The FIS1 Protein plays a crucial role in the fragmentation of the mitochondrial network, contributing to its perinuclear clustering. While it has a minor role in recruiting and associating with the fission mediator dynamin-related protein 1 (DNM1L) on the mitochondrial surface, FIS1 is implicated in mitochondrial fission. Notably, it may not be essential for the assembly of functional fission complexes and subsequent membrane scission events. Beyond its involvement in mitochondrial dynamics, FIS1 also mediates peroxisomal fission, particularly when the outcomes of fission are directed towards mitochondrial homeostasis, mitophagy, or apoptosis. The protein can induce the release of cytochrome c from the mitochondrion to the cytosol, ultimately triggering apoptosis. Interactions with DNM1L/DLP1, MARCHF5, MIEF1, and PEX11A, PEX11B, PEX11G highlight the intricate network of associations that contribute to FIS1's multifaceted role at the interface of mitochondrial and peroxisomal dynamics.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q9Y3D6 (M1-G122)

Gene ID
Molecular Construction
N-term
FIS1 (M1-G122)
Accession # Q9Y3D6
6*His
C-term
Synonyms
Mitochondrial Fission 1 Protein; FIS1 Homolog; hFis1; Tetratricopeptide Repeat Protein 11; TPR Repeat Protein 11; FIS1; TTC11; CGI-135
AA Sequence

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG

Molecular Weight

Approximately 15.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

FIS1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FIS1 Protein, Human (His)
Cat. No.:
HY-P70941
Quantity:
MCE Japan Authorized Agent: