FKBP3 Protein, Human (His)

FKBP3 is a member of the FK506 and rapamycin-binding protein (FKBP) family and serves as a receptor for the immunosuppressants FK506 and rapamycin, both of which inhibit two distinct cytoplasmic signaling pathways. T cell proliferation. In addition to serving as a receptor for these immunosuppressants, FKBP3, like other peptidyl prolyl cis-trans isomerases (PPIases), also functions to accelerate protein folding. FKBP3 Protein, Human (His) is the recombinant human-derived FKBP3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of FKBP3 Protein, Human (His) is 224 a.a., with molecular weight of ~30.0 kDa.

FKBP3, also known as FK506-binding protein 3, is a member of the FK506- and rapamycin-binding protein (FKBP) family, which acts as receptors for the immunosuppressants FK506 and rapamycin. These proteins play a crucial role in inhibiting T-cell proliferation by disrupting two distinct cytoplasmic signal transmission pathways. FKBP3, like other members of the family, possesses peptidyl-prolyl isomerase (PPIase) activity, which accelerates the folding of proteins. The PPIase function of FKBP3 is significant in facilitating the proper conformation and maturation of proteins, emphasizing its role beyond immunosuppression in cellular processes related to protein folding.

Human

E. coli

N-6*His

Q00688 (M1-D224)

2287  [NCBI]

MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Approximately 30.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.