FkpA Protein, E.coli (His-SUMO)

The FkpA protein plays a central role in cellular processes, acting as a key catalyst in the complex dance of protein folding. Its catalytic efficiency is excellent in promoting the cis-trans isomerization of proline-imine peptide bonds, thus accelerating the overall folding of proteins. FkpA Protein, E.coli (His-SUMO) ) is the recombinant E. coli-derived FkpA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

At the forefront of cellular machinery, the FkpA protein emerges as a key catalyst in expediting the intricate process of protein folding. Its catalytic prowess is particularly evident in the facilitation of cis-trans isomerization of proline imidic peptide bonds within oligopeptides. By orchestrating these precise structural changes, FkpA significantly accelerates the overall folding of proteins, unveiling its vital role in ensuring the timely and accurate formation of functional protein structures. This molecular finesse highlights FkpA's importance in the complex choreography of cellular processes, emphasizing its contribution to maintaining cellular homeostasis.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

E.coli

E. coli

N-His;N-SUMO

P65764 (A26-K270)

75206290  [NCBI]

AEAAKPATTADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK

Approximately 48 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.