Follistatin-like 1/FSTL1 Protein, Rat (HEK293, C-His)

The Follistatin-like 1/FSTL1 protein binds calcium ions and heparin. It is involved in endothelial cell differentiation, migration, and BMP signaling regulation. FSTL1 also contributes to hematopoietic stem cell homeostasis. It is located in the extracellular region and is expressed in tissues like the heart and lung. The Alliance of Genome Resources supports its function. Follistatin-like 1/FSTL1 Protein, Rat (HEK293, C-His) is the recombinant rat-derived Follistatin-like 1/FSTL1 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Follistatin-like 1/FSTL1 Protein, Rat (HEK293, C-His) is 288 a.a., with molecular weight of 37-48 kDa.

The Follistatin-like 1 (FSTL1) protein is predicted to have calcium ion binding and heparin binding activity. It is also predicted to be involved in processes such as endothelial cell differentiation, endothelial cell migration, and regulation of the BMP signaling pathway. Additionally, it is predicted to play a role in hematopoietic stem cell homeostasis and is located in the extracellular region. The FSTL1 protein is orthologous to the human FSTL1 gene and its function is supported by the Alliance of Genome Resources. It shows biased expression in tissues such as the heart, lung, and nine other tissues.

Immobilized Recombinant Follistatin-like 1/FSTL1 at 2 μg/ml (100 μl/well) can bind Biotinylated Recombinant human BMP-4 Protein. The ED₅₀ for this effect is 101.5 ng/mL.

• 
  Immobilized Recombinant Follistatin‑like 1/FSTL1 at 2 μg/ml (100 μl/well) can bind Biotinylated Recombinant human BMP-4 Protein. The ED₅₀ for this effect is 101.5 ng/mL.

Rat

HEK293

C-10*His

NP_077345.1 (E19-I306)

79210

EEEQRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQANRDELRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKSFDNGDSHLDSSEFLKFVEQNETAVNITAYPNQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCSCGHWVCTAMTCDGKNQKGVQTHTEEEMTRYAQELQKHQGTAEKTKKVNTKEI

37-48 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.