1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Follistatin-like 1/FSTL1 Protein, Rat (HEK293, C-His)

Follistatin-like 1/FSTL1 Protein, Rat (HEK293, C-His)

Cat. No.: HY-P75781A
SDS COA Handling Instructions Technical Support

The Follistatin-like 1/FSTL1 protein binds calcium ions and heparin. It is involved in endothelial cell differentiation, migration, and BMP signaling regulation. FSTL1 also contributes to hematopoietic stem cell homeostasis. It is located in the extracellular region and is expressed in tissues like the heart and lung. The Alliance of Genome Resources supports its function. Follistatin-like 1/FSTL1 Protein, Rat (HEK293, C-His) is the recombinant rat-derived Follistatin-like 1/FSTL1 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Follistatin-like 1/FSTL1 Protein, Rat (HEK293, C-His) is 288 a.a., with molecular weight of 37-48 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Follistatin-like 1/FSTL1 protein binds calcium ions and heparin. It is involved in endothelial cell differentiation, migration, and BMP signaling regulation. FSTL1 also contributes to hematopoietic stem cell homeostasis. It is located in the extracellular region and is expressed in tissues like the heart and lung. The Alliance of Genome Resources supports its function. Follistatin-like 1/FSTL1 Protein, Rat (HEK293, C-His) is the recombinant rat-derived Follistatin-like 1/FSTL1 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Follistatin-like 1/FSTL1 Protein, Rat (HEK293, C-His) is 288 a.a., with molecular weight of 37-48 kDa.

Background

The Follistatin-like 1 (FSTL1) protein is predicted to have calcium ion binding and heparin binding activity. It is also predicted to be involved in processes such as endothelial cell differentiation, endothelial cell migration, and regulation of the BMP signaling pathway. Additionally, it is predicted to play a role in hematopoietic stem cell homeostasis and is located in the extracellular region. The FSTL1 protein is orthologous to the human FSTL1 gene and its function is supported by the Alliance of Genome Resources. It shows biased expression in tissues such as the heart, lung, and nine other tissues.

Biological Activity

Immobilized Recombinant Follistatin-like 1/FSTL1 at 2 μg/ml (100 μl/well) can bind Biotinylated Recombinant human BMP-4 Protein. The ED50 for this effect is 101.5 ng/mL.

  • Immobilized Recombinant Follistatin‑like 1/FSTL1 at 2 μg/ml (100 μl/well) can bind Biotinylated Recombinant human BMP-4 Protein. The ED50 for this effect is 101.5 ng/mL.
Species

Rat

Source

HEK293

Tag

C-10*His

Accession

NP_077345.1 (E19-I306)

Gene ID

79210

Molecular Construction
N-term
FSTL1 (E19-I306)
Accession # NP_077345.1
10*His
C-term
Synonyms
Follistatin-related protein 1; Follistatin-like protein 1; FSTL1; FRP
AA Sequence

EEEQRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQANRDELRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKSFDNGDSHLDSSEFLKFVEQNETAVNITAYPNQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCSCGHWVCTAMTCDGKNQKGVQTHTEEEMTRYAQELQKHQGTAEKTKKVNTKEI

Molecular Weight

37-48 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Follistatin-like 1/FSTL1 Protein, Rat (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Follistatin-like 1/FSTL1 Protein, Rat (HEK293, C-His)
Cat. No.:
HY-P75781A
Quantity:
MCE Japan Authorized Agent: