Follistatin-like 1/FSTL1 Protein, Rat (HEK293, His, solution)

The Follistatin-like 1/FSTL1 protein binds calcium ions and heparin. It is involved in endothelial cell differentiation, migration, and BMP signaling regulation. FSTL1 also contributes to hematopoietic stem cell homeostasis. It is located in the extracellular region and is expressed in tissues like the heart and lung. The Alliance of Genome Resources supports its function. Follistatin-like 1/FSTL1 Protein, Rat (HEK293, His, solution) is the recombinant rat-derived Follistatin-like 1/FSTL1 protein, expressed by HEK293 , with C-10*His labeled tag.

The Follistatin-like 1 (FSTL1) protein is predicted to have calcium ion binding and heparin binding activity. It is also predicted to be involved in processes such as endothelial cell differentiation, endothelial cell migration, and regulation of the BMP signaling pathway. Additionally, it is predicted to play a role in hematopoietic stem cell homeostasis and is located in the extracellular region. The FSTL1 protein is orthologous to the human FSTL1 gene and its function is supported by the Alliance of Genome Resources. It shows biased expression in tissues such as the heart, lung, and nine other tissues.

Rat

HEK293

C-10*His

NP_077345.1 (E19-I306)

79210  [NCBI]

EEEQRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQANRDELRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKSFDNGDSHLDSSEFLKFVEQNETAVNITAYPNQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCSCGHWVCTAMTCDGKNQKGVQTHTEEEMTRYAQELQKHQGTAEKTKKVNTKEI

Approximately 34 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.