Frizzled-1 Protein, Mouse (HEK293, Fc)

Frizzled-1 is a Wnt receptor that is primarily activated by WNT7B and to varying degrees by WNT3A, WNT3, WNT1, and WNT2, while resisting activation by other Wnt proteins. Its fundamental role in canonical Wnt/β-catenin signaling involves promiscuous activation, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Frizzled-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Frizzled-1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Frizzled-1 Protein, Mouse (HEK293, Fc) is 180 a.a., with molecular weight of 55-70 kDa.

Frizzled-1, a receptor for Wnt proteins, is prominently activated by WNT7B and, to varying degrees, by WNT3A, WNT3, WNT1, and WNT2, while showing resistance to activation by WNT4, WNT5A, WNT5B, WNT6, WNT7A, or WNT7B in certain contexts. Its involvement in the canonical Wnt/beta-catenin signaling pathway is fundamental, instigating the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. The presence of an alternative signaling pathway involving PKC and calcium fluxes adds intricacy, with unresolved questions regarding its integration with the canonical pathway. Frizzled-1 may play a crucial role in transducing polarity information during tissue morphogenesis and in differentiated tissues, underscoring its multifaceted contributions. Notably, interactions with MYOC and WNT7B further emphasize its intricate involvement in diverse cellular processes.

Mouse

HEK293

C-hFc

O70421 (V69-H248)

14362  [NCBI]

VRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGISIPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQH

55-70 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.