Frizzled-10/CD350 Protein, Human (HEK293, His)

The Frizzled-10/CD350 gene is a member of the Frizzled gene family, encoding a 7-transmembrane domain protein that acts as a receptor for the Wingless-type MMTV integration site family signaling protein. Most Frizzled receptors, including Frizzled-10/CD350, are involved in cell signaling, specifically the β-catenin classical pathway. Frizzled-10/CD350 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-10/CD350 protein, expressed by HEK293 , with C-His labeled tag. The total length of Frizzled-10/CD350 Protein, Human (HEK293, His) is 141 a.a., with molecular weight of 20-25 kDa.

The Frizzled-10/CD350 gene belongs to the frizzled gene family, encoding 7-transmembrane domain proteins serving as receptors for the Wingless type MMTV integration site family of signaling proteins. Typically associated with the beta-catenin canonical signaling pathway, most frizzled receptors play crucial roles in cellular signaling. Notably, through array analysis, expression of this intronless gene demonstrates a significant up-regulation in two instances of primary colon cancer. This suggests a potential involvement of Frizzled-10/CD350 in the context of colon cancer, prompting further exploration of its specific contributions to signaling pathways and cancer progression.

Measured by its ability to bind biotinylated recombinant mouse Wnt-3a in a functional ELISA. The ED₅₀ for this effect is 4.336 nM.

• 
  Measured by its ability to bind biotinylated recombinant mouse Wnt-3a in a functional ELISA. The ED₅₀ for this effect is 4.336nM.

Human

HEK293

C-6*His

NP_009128.1 (I21-G161)

11211  [NCBI]

ISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRG

Approximately 20-25 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.