Frizzled-4/CD344 Protein, Human (HEK293, His)

The Frizzled-4/CD344 protein is a receptor for Wnt proteins and is associated with the classical β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target genes. In retinal vascularization, it acts as a receptor for Wnt proteins and Norrin (NDP), stimulating β-catenin accumulation and LEF/TCF-mediated transcription. Frizzled-4/CD344 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-His labeled tag. The total length of Frizzled-4/CD344 Protein, Human (HEK293, His) is 144 a.a., with molecular weight of ~22-25 kDa.

Frizzled-4/CD344 Protein serves as a receptor for Wnt proteins, particularly associated with the canonical beta-catenin signaling pathway, involving the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. In the context of retinal vascularization, Frizzled-4 plays a pivotal role by acting as a receptor for both Wnt proteins and norrin (NDP), facilitating beta-catenin accumulation and stimulation of LEF/TCF-mediated transcriptional programs. Although a secondary signaling pathway, featuring PKC and calcium fluxes, has been observed in some family members, its integration with the canonical pathway, particularly in the context of Wnt-mediated inactivation of GSK-3 kinase, remains uncertain. Frizzled-4's involvement in tissue morphogenesis and intercellular transmission of polarity information is suggested, with interactions observed with MAGI3, NDP, TSKU, and glypican GPC3, highlighting its intricate role in cellular processes and signaling cascades.

Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-4, at 0.1 μg/mL (100 μL/well) can bind Wnt-5a. The ED₅₀ for this effect is 26.59 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-4, at 0.1 μg/mL (100 μL/well) can bind Wnt-5a. The ED₅₀ for this effect is 26.59 ng/mL.

Human

HEK293

C-His

Q9ULV1 (F37-E180)

8322  [NCBI]

FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE

Approximately 22-25 kDa due to glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.