Frizzled-7 Protein, Human (HEK293, His)

Frizzled-7 (FZD7) is a Wnt receptor that primarily activates the β-catenin classical pathway, involving Disheveled protein, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Some family members exhibit a second PKC and calcium flux signaling pathway, but the integration is unclear. Frizzled-7/FZD7 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-7/FZD7 protein, expressed by HEK293 , with C-His labeled tag.

Frizzled-7 (FZD7), serving as a receptor for Wnt proteins, predominantly operates through the beta-catenin canonical signaling pathway, initiating a cascade that involves disheveled proteins, GSK-3 kinase inhibition, nuclear accumulation of beta-catenin, and the activation of Wnt target genes. While a second signaling pathway involving PKC and calcium fluxes has been observed in some family members, its distinctiveness and potential integration with the canonical pathway remain unclear, with PKC seemingly required for Wnt-mediated GSK-3 kinase inactivation. Activation by WNT8 induces the expression of beta-catenin target genes. Upon ligand activation, FZD7 interacts with CCDC88C/DAPLE, displacing DVL1 and inhibiting canonical Wnt signaling, leading to G-protein activation by CCDC88C and the initiation of non-canonical Wnt responses. This intricate involvement suggests FZD7's potential role in transducing polarity information during tissue morphogenesis and/or in differentiated tissues. Additionally, in the context of microbial infection, FZD7 acts as a receptor for C. difficile toxin TcdB in the colonic epithelium.

Measured by its binding ability in a functional ELISA. In a 100 µL reaction mixture containing biotinylated Wnt-5a at 100 ng/mL and Frizzled-7 dilutions at 0.98-2000 ng/mL. The ED₅₀ for this effect is 73.1 ng/mL.

Human

HEK293

C-6*His

O75084 (Q33-L185)

8324  [NCBI]

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Approximately 23-33 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.