1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled
  5. Frizzled-7
  6. Frizzled-7 Protein, Human (HEK293, His)

Frizzled-7 (FZD7) is a Wnt receptor that primarily activates the β-catenin classical pathway, involving Disheveled protein, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Some family members exhibit a second PKC and calcium flux signaling pathway, but the integration is unclear. Frizzled-7/FZD7 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-7/FZD7 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Frizzled-7 (FZD7) is a Wnt receptor that primarily activates the β-catenin classical pathway, involving Disheveled protein, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Some family members exhibit a second PKC and calcium flux signaling pathway, but the integration is unclear. Frizzled-7/FZD7 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-7/FZD7 protein, expressed by HEK293 , with C-His labeled tag.

Background

Frizzled-7 (FZD7), serving as a receptor for Wnt proteins, predominantly operates through the beta-catenin canonical signaling pathway, initiating a cascade that involves disheveled proteins, GSK-3 kinase inhibition, nuclear accumulation of beta-catenin, and the activation of Wnt target genes. While a second signaling pathway involving PKC and calcium fluxes has been observed in some family members, its distinctiveness and potential integration with the canonical pathway remain unclear, with PKC seemingly required for Wnt-mediated GSK-3 kinase inactivation. Activation by WNT8 induces the expression of beta-catenin target genes. Upon ligand activation, FZD7 interacts with CCDC88C/DAPLE, displacing DVL1 and inhibiting canonical Wnt signaling, leading to G-protein activation by CCDC88C and the initiation of non-canonical Wnt responses. This intricate involvement suggests FZD7's potential role in transducing polarity information during tissue morphogenesis and/or in differentiated tissues. Additionally, in the context of microbial infection, FZD7 acts as a receptor for C. difficile toxin TcdB in the colonic epithelium.

Biological Activity

Measured by its binding ability in a functional ELISA. In a 100 µL reaction mixture containing biotinylated Wnt-5a at 100 ng/mL and Frizzled-7 dilutions at 0.98-2000 ng/mL. The ED50 for this effect is 73.1 ng/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O75084 (Q33-L185)

Gene ID
Molecular Construction
N-term
Frizzled-7 (Q33-L185)
Accession # O75084
His
C-term
Synonyms
FZD7; Frizzled-7; FzE3; Fz-7; hFz7
AA Sequence

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Weight

Approximately 23-33 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Frizzled-7 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Frizzled-7 Protein, Human (HEK293, His)
Cat. No.:
HY-P78730
Quantity:
MCE Japan Authorized Agent: