1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. FSH
  5. FSH beta
  6. FSH beta Protein, Human (HEK293, His)

FSH beta Protein, Human (HEK293, His)

Cat. No.: HY-P70238
SDS COA Handling Instructions

The FSH beta protein and the alpha chain CGA form follicle-stimulating hormone, which gives the hormone heterodimer biological specificity. It binds to FSHR on target cells and initiates downstream signaling, which is critical for follicle development and spermatogenesis. FSH beta Protein, Human (HEK293, His) is the recombinant human-derived FSH beta protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FSH beta Protein, Human (HEK293, His) is 111 a.a., with molecular weight of ~21.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FSH beta protein and the alpha chain CGA form follicle-stimulating hormone, which gives the hormone heterodimer biological specificity. It binds to FSHR on target cells and initiates downstream signaling, which is critical for follicle development and spermatogenesis. FSH beta Protein, Human (HEK293, His) is the recombinant human-derived FSH beta protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FSH beta Protein, Human (HEK293, His) is 111 a.a., with molecular weight of ~21.0 kDa.

Background

FSH beta Protein, in conjunction with the alpha chain CGA, forms follitropin, the follicle-stimulating hormone, conferring its biological specificity to the hormone heterodimer. This protein binds to FSHR, a G protein-coupled receptor on target cells, initiating downstream signaling pathways. Follitropin plays a crucial role in follicle development and spermatogenesis in reproductive organs. Structured as a heterodimer, the active follitropin consists of an alpha chain/CGA shared with other hormones and a distinctive beta chain/FSHB. Through its interaction with FSHR, FSH beta Protein contributes to the regulation of reproductive processes, highlighting its significance in the intricate orchestration of fertility and reproductive health.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P01225 (N19-E129)

Gene ID
Molecular Construction
N-term
FSH beta (N19-E129)
Accession # P01225
6*His
C-term
Synonyms
rHuFollitropin subunit beta/FSHB, His; Follitropin Subunit Beta; Follicle-Stimulating Hormone Beta Subunit; FSH-B; FSH-Beta; Follitropin Beta Chain; FSHB
AA Sequence

NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Molecular Weight

Approximately 21.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FSH beta Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FSH beta Protein, Human (HEK293, His)
Cat. No.:
HY-P70238
Quantity:
MCE Japan Authorized Agent: