FTCD Protein, Human (sf9, His)

The FTCD protein is a folate-dependent enzyme with dual functions of transferase and deaminase activities. It plays a crucial role in directing the one-carbon units from methyliminoglutamic acid into the folate pool, contributing to the regulation of folate metabolism. FTCD Protein, Human (sf9, His) is the recombinant human-derived FTCD protein, expressed by Sf9 insect cells , with C-His labeled tag.

The FTCD (Formimidoyltransferase-Cyclodeaminase) protein is a folate-dependent enzyme known for its versatile functionality, featuring both transferase and deaminase activities. Its primary role involves directing one-carbon units from formiminoglutamate to the folate pool, contributing to essential cellular processes. Moreover, FTCD exhibits an additional function by binding to and facilitating the bundling of vimentin filaments that originate from the Golgi apparatus. This dual role in one-carbon metabolism and cytoskeletal organization highlights the significance of FTCD in cellular homeostasis.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

Sf9 insect cells

C-His

O95954-1 (M1-E541)

10841  [NCBI]

MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Approximately 60.4 kDa.

Greater than 90% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 16 mM Hepes, 250 mM NaCl, 20 % glycerol, pH 7.6.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.