1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. FtsZ Protein, E.coli (His-SUMO)

FtsZ is an essential cell division protein that plays a central role in coordinating the formation of the contractile Z ring at the site of expected cell division. Precise regulation of the components of this ring is a key determinant, affecting the timing and location of cell division. FtsZ Protein, E.coli (His-SUMO) is the recombinant E. coli-derived FtsZ protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of FtsZ Protein, E.coli (His-SUMO) is 383 a.a., with molecular weight of ~56.3 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FtsZ is an essential cell division protein that plays a central role in coordinating the formation of the contractile Z ring at the site of expected cell division. Precise regulation of the components of this ring is a key determinant, affecting the timing and location of cell division. FtsZ Protein, E.coli (His-SUMO) is the recombinant E. coli-derived FtsZ protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of FtsZ Protein, E.coli (His-SUMO) is 383 a.a., with molecular weight of ~56.3 kDa.

Background

FtsZ (Filamenting temperature-sensitive mutant Z) protein is an indispensable component of cell division, playing a central role in the formation of the contractile ring structure known as the Z ring at the future site of cell division. The assembly of this ring is crucial for regulating the timing and location of cell division. Functionally, the FtsZ ring serves to recruit various other cell division proteins to the septum, facilitating the synthesis of a new cell wall between dividing cells. As a GTP-binding protein with intrinsic GTPase activity, FtsZ exists as a homodimer and polymerizes to create a dynamic ring structure in a strictly GTP-dependent manner. This dynamic interaction with GTP and its ability to form the Z ring are essential features, highlighting FtsZ's pivotal role in orchestrating the complex process of bacterial cell division. Moreover, FtsZ directly interacts with several other division proteins, emphasizing its central role in coordinating the molecular events necessary for successful cell division (

Species

E.coli

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

P0A9A7 (M1-D383)

Gene ID

75202088  [NCBI]

Molecular Construction
N-term
6*His-SUMO
FtsZ (M1-D383)
Accession # P0A9A7
C-term
Synonyms
ftsZ; c0113Cell division protein FtsZ
AA Sequence

MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD

Molecular Weight

Approximately 56.3 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FtsZ Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FtsZ Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71495
Quantity:
MCE Japan Authorized Agent: