1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. G-CSF
  5. G-CSF Protein, Human (HEK293)

G-CSF Protein, Human (HEK293)

Cat. No.: HY-P73523
SDS COA Handling Instructions

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with tag free. The total length of G-CSF Protein, Human (HEK293) is 175 a.a., with molecular weight of ~17.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg $40 In-stock
5 μg $75 In-stock
10 μg $120 In-stock
50 μg $315 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with tag free. The total length of G-CSF Protein, Human (HEK293) is 175 a.a., with molecular weight of ~17.8 kDa.

Background

Granulocyte/macrophage colony-stimulating factor (G-CSF) is a cytokine crucial for hematopoiesis, exerting control over the production, differentiation, and function of two key white cell populations: granulocytes and monocytes-macrophages. As a monomeric protein, G-CSF specifically induces the development of granulocytes, contributing to the regulation of the immune system and blood cell formation.

Biological Activity

Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells and the ED50 is typically 0.04-0.2 ng/mL.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P09919-2/NP_757373.1 (A30-P204)

Gene ID
Molecular Construction
N-term
G-CSF (A30-P204)
Accession # P09919-2
C-term
Synonyms
Granulocyte Colony-Stimulating Factor; G-CSF; CSF3; C17orf33
AA Sequence

ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Weight

Approximately 17.8 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

G-CSF Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
G-CSF Protein, Human (HEK293)
Cat. No.:
HY-P73523
Quantity:
MCE Japan Authorized Agent: