1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. G-CSF
  5. G-CSF Protein, Mouse (CHO)

G-CSF Protein, Mouse (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg Get quote
500 μg Get quote
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE G-CSF Protein, Mouse (CHO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

G-CSF Protein, Mouse (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

Background

Granulocyte Colony Stimulating Factor (G-CSF) is a cytokine that normally acts in the bone marrow microenvironment to stimulate blood cell formation. It selectively promotes growth and maturation of neutrophil progenitor cells. Granulocyte Colony Stimulating Factor receptors are present on precursor cells in the bone marrow. By binding to these receptors, Granulocyte Colony Stimulating Factor initiates proliferation and differentiation into mature granulocytes, and also stimulates bone marrow cell release into the circulation. In addition to growth promotion, Granulocyte Colony Stimulating Factor also effects phagocytosis, motility, bactericidal activity and surface molecule expression of neutrophils and monocytes[1][2]. G-CSF production is induced by several inflammatory stimuli that become rapidly elevated during infection such as interleukin-1β (IL-1β), tumor necrosis factor-alpha (TNFα) and lipopolysaccaride (LPS). Therefore, pathogen-mediated activation of host pattern recognition receptors via LPS, and the host cytokine response to infection, serve to induce circulating levels of G-CSF[3].

Biological Activity

The ED50 is ≤0.03343 ng/mL as measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells.

  • Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 33.43 pg/mL, corresponding to a specific activity is 2.99×107 units/mg.
Species

Mouse

Source

CHO

Tag

Tag Free

Accession

P09920 (V31-A208)

Gene ID
Molecular Construction
N-term
G-CSF (V31-A208)
Accession # P09920
C-term
Synonyms
rMuG-CSF; CSF-3; MGI-1G; Pluripoietin; Molgramostin; Sargramostim
AA Sequence

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Molecular Weight

Approximately 21-24 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

G-CSF Protein, Mouse (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
G-CSF Protein, Mouse (CHO)
Cat. No.:
HY-P7068
Quantity:
MCE Japan Authorized Agent: