G-CSF Protein, Mouse (HEK293, His)

The G-CSF Protein, a monomeric cytokine in the granulocyte/macrophage colony-stimulating factor family, crucially regulates hematopoiesis by orchestrating the production, differentiation, and function of granulocytes and monocytes-macrophages. Its production emphasizes its significance in maintaining immune system balance and functionality. G-CSF Protein, Mouse (HEK293, His) is the recombinant mouse-derived G-CSF protein, expressed by HEK293 , with C-6*His labeled tag.

The G-CSF Protein, a member of the granulocyte/macrophage colony-stimulating factors, plays a crucial role in hematopoiesis by regulating the production, differentiation, and function of two closely related white cell populations in the blood: granulocytes and monocytes-macrophages. Specifically, this cytokine induces the generation of granulocytes, contributing to the intricate orchestration of hematopoietic processes.

Measured in a cell proliferation assay using NFS 60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is ≤103.9 pg/mL, corresponding to a specific activity is ≥6.9624×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using NFS 60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is 103.9 pg/mL, corresponding to a specific activity is 6.9624×10⁶ units/mg.

Mouse

HEK293

C-6*His

P09920 (V31-A208)

12985  [NCBI]

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Approximately 22-30 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 10 mM Sodium Citrate, 0.1% Tween 20, pH 3.5 or 20 mM PB, 150 mM NaCl, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.0, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.