1. Recombinant Proteins
  2. Receptor Proteins
  3. G6B Protein, Human (HEK293, His)

The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag.

Background

G6B, an inhibitory receptor, plays a crucial role in regulating hematopoietic lineage differentiation, megakaryocyte function, and platelet production. This regulatory function extends to inhibiting platelet aggregation and activation induced by various agonists like ADP and collagen-related peptide. The inhibition is mediated through the receptor's impact on CLEC1B and GP6:FcRgamma signaling, involving two immunoreceptor tyrosine-based inhibitor motifs (ITIMs). Notably, G6B operates in a calcium-independent manner. Isoform B, containing both a transmembrane region and the mentioned ITIMs, serves as the inhibitory counterpart, while isoform A is considered the activating counterpart of isoform B. This dual-isoform system reflects the nuanced regulatory mechanisms underlying hematopoiesis and platelet function.

Biological Activity

Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED50 for this effect is 2.344 μg/mL, corresponding to a specific activity is 4.266×10^2 U/mg.

  • Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED50 for this effect is 2.344 μg/mL, corresponding to a specific activity is 4.266×102 U/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

O95866-1/NP_612116.1 (N18-Q142)

Gene ID
Molecular Construction
N-term
G6B (N18-Q142)
Accession # O95866-1/NP_612116.1
His
C-term
Synonyms
Megakaryocyte and platelet inhibitory receptor G6b; Protein G6b; MPIG6B; C6orf25; G6B-B
AA Sequence

NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ

Molecular Weight

Approximately 18-23 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

G6B Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
G6B Protein, Human (HEK293, His)
Cat. No.:
HY-P75785
Quantity:
MCE Japan Authorized Agent: