GABARAPL1/GEC-1 Protein, Human (His)

GABARAPL1/GEC-1 is a multifunctional ubiquitin-like modifier that contributes to cell surface expression of kappa-type opioid receptors and contributes to autophagy, shaping autophagosome vacuoles.Unlike LC3, which is involved in phagophore elongation, the GABARAP/GATE-16 subfamily plays a crucial role in late autophagosome maturation.GABARAPL1/GEC-1 Protein, Human (His) is the recombinant human-derived GABARAPL1/GEC-1 protein, expressed by E.coli , with N-6*His labeled tag.

GABARAPL1/GEC-1, a ubiquitin-like modifier, plays a multifaceted role in cellular processes. It enhances the cell-surface expression of kappa-type opioid receptors by facilitating their anterograde intracellular trafficking. Additionally, GABARAPL1/GEC-1 contributes to autophagy, participating in the formation of autophagosomal vacuoles. While LC3s are associated with phagophore membrane elongation, the GABARAP/GATE-16 subfamily assumes a crucial role in later stages of autophagosome maturation. Furthermore, GABARAPL1/GEC-1 collaborates with the reticulophagy receptor TEX264 to remodel subdomains of the endoplasmic reticulum into autophagosomes during nutrient stress, facilitating subsequent fusion with lysosomes for endoplasmic reticulum turnover. The protein engages in a network of interactions with various partners, including ATG13, OPRK1, RB1CC1, ULK1, TP53INP1, TP53INP2, SQSTM1, ATG3, ATG7, MAP15, TECPR2, TBC1D5, MAPK15, TRIM5, MEFV, TRIM21, WDFY3, UBA5, KBTBD6, KBTBD7, RETREG1, RETREG2, RETREG3, TEX264, and IRGM, underscoring its significance in cellular homeostasis and autophagic processes.

Human

E. coli

N-6*His

Q9H0R8 (M1-K117)

23710  [NCBI]

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Approximately 20.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of sterile 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.