1. Recombinant Proteins
  2. Others
  3. GADD45G/DDIT2 Protein, Human (His)

GADD45G/DDIT2 protein is a key mediator that regulates growth and apoptosis through the MTK1/MEKK4 MAPKKK signaling pathway. Concentration-dependent homodimerization enhances its growth inhibitory activity and interaction with PCNA, suggesting a role in DNA repair. GADD45G/DDIT2 Protein, Human (His) is the recombinant human-derived GADD45G/DDIT2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GADD45G/DDIT2 Protein, Human (His) is 159 a.a., with molecular weight of ~21.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GADD45G/DDIT2 protein is a key mediator that regulates growth and apoptosis through the MTK1/MEKK4 MAPKKK signaling pathway. Concentration-dependent homodimerization enhances its growth inhibitory activity and interaction with PCNA, suggesting a role in DNA repair. GADD45G/DDIT2 Protein, Human (His) is the recombinant human-derived GADD45G/DDIT2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GADD45G/DDIT2 Protein, Human (His) is 159 a.a., with molecular weight of ~21.0 kDa.

Background

The GADD45G/DDIT2 Protein plays a pivotal role in the regulation of both growth and apoptosis, acting as a mediator in the activation of the stress-responsive MTK1/MEKK4 MAPKKK signaling pathway. The protein undergoes concentration-dependent homodimerization, a crucial aspect for its growth inhibitory activity, and this homodimerization enhances its interaction with PCNA. GADD45G/DDIT2 further interacts with GADD45GIP1, forming a molecular complex that likely contributes to the modulation of cellular responses, particularly under stress conditions. Additionally, its interaction with PCNA suggests a role in DNA repair processes, highlighting the multifaceted functions of GADD45G/DDIT2 in coordinating cellular responses to stress and influencing essential pathways that govern growth and apoptosis.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O95257 (M1-E159)

Gene ID
Molecular Construction
N-term
6*His
GADD45G (M1-E159)
Accession # O95257
C-term
Synonyms
rHuGrowth arrest and DNA damage-inducible protein GADD45 gamma/GADD45G, His; Growth Arrest and DNA Damage-Inducible Protein GADD45 Gamma; Cytokine-Responsive Protein CR6; DNA Damage-Inducible Transcript 2 Protein; DDIT-2; GADD45G; CR6; DDIT2
AA Sequence

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Molecular Weight

Approximately 21.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GADD45G/DDIT2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GADD45G/DDIT2 Protein, Human (His)
Cat. No.:
HY-P70218
Quantity:
MCE Japan Authorized Agent: