Gag-Pol polyprotein, HIV (440a.a, His)

The Gag-Pol polyprotein plays a central role in virion assembly, cooperating with Gag to bind to the plasma membrane, promote protein-protein interactions, recruit viral Env proteins, and package genomic RNA through direct interaction with the RNA packaging sequence (Psi). Gag-Pol polyprotein, HIV (440a.a, His) is the recombinant Virus-derived Gag-Pol polyprotein, expressed by E. coli , with N-6*His labeled tag.

The Gag-Pol polyprotein assumes a central role in the virion assembly process, collaborating with the Gag polyprotein to orchestrate essential events such as binding to the plasma membrane, facilitating protein-protein interactions crucial for spherical particle formation, recruiting viral Env proteins, and packaging genomic RNA through direct interactions with the RNA packaging sequence (Psi). This polyprotein potentially regulates its own translation by binding genomic RNA in the 5'-UTR, exhibiting a dual role in promoting translation at low concentrations and encapsidating genomic RNA to inhibit translation at higher concentrations. The multipartite membrane-binding signal, including the myristoylated N-terminus, targets the polyprotein to the plasma membrane. Additionally, the Matrix protein within the polyprotein is implicated in the pre-integration complex and is associated with the release from the host cell mediated by Vpu. The ability of Gag-Pol to bind to RNA further underscores its multifaceted functions in the intricate process of virion assembly.

Virus

E. coli

N-6*His

P04585-1 (P588-F1027)

155348  [NCBI]

PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF

Approximately 54 kDa.

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 250 mM Nacl, 1 mM EDTA, 50 % glycerol, pH 7.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.