Galactokinase/GALK1 Protein, Human (His)

Galactokinase (GALK1) protein facilitates the transfer of a phosphate group from ATP to alpha-D-galactose, playing a pivotal role in the initial and committed step of galactose catabolism. Through this enzymatic activity, GALK1 initiates the metabolic pathway responsible for breaking down galactose, contributing to its utilization within cellular processes. Galactokinase/GALK1 Protein, Human (His) is the recombinant human-derived Galactokinase/GALK1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of Galactokinase/GALK1 Protein, Human (His) is 392 a.a., with molecular weight of ~45.0 kDa.

Galactokinase (GALK1) is an enzyme that plays a pivotal role in the catabolism of galactose by catalyzing the transfer of a phosphate group from ATP to alpha-D-galactose. This enzymatic activity represents the first committed step in the metabolic pathway of galactose, initiating its conversion into downstream metabolites. The phosphorylation of galactose by GALK1 is a crucial step in galactose utilization and allows for subsequent enzymatic reactions leading to the incorporation of galactose-derived metabolites into various cellular processes. Understanding the functions of GALK1 provides insights into the regulation of galactose metabolism and its importance in cellular energy production and the synthesis of glycoconjugates.

Human

E. coli

C-6*His

P51570 (M1-L392)

2584  [NCBI]

MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL

Approximately 45.0 kDa

Greater than 85% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.