1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Galanin
  5. Galanin Protein, Human (HEK293, Fc)

Galanin exists as an endocrine hormone in the central and peripheral nervous systems and exerts its effects by binding to and activating G protein-coupled receptors (i.e., GALR1, GALR2, and GALR3). Galanin Protein, Human (HEK293, Fc) is the recombinant human-derived Galanin protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Galanin Protein, Human (HEK293, Fc) is 104 a.a., with molecular weight of ~43 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Galanin exists as an endocrine hormone in the central and peripheral nervous systems and exerts its effects by binding to and activating G protein-coupled receptors (i.e., GALR1, GALR2, and GALR3). Galanin Protein, Human (HEK293, Fc) is the recombinant human-derived Galanin protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Galanin Protein, Human (HEK293, Fc) is 104 a.a., with molecular weight of ~43 kDa.

Background

Galanin is a neuropeptide acting as an endocrine hormone in both the central and peripheral nervous systems, engaging G protein-coupled receptors, specifically GALR1, GALR2, and GALR3. This small protein exerts regulatory control over a range of physiological functions, including the contraction of smooth muscles in the gastrointestinal and genitourinary tract, as well as the modulation of growth hormone and insulin release, and adrenal secretion. By binding to its specific receptors, galanin plays a multifaceted role in coordinating various physiological processes, highlighting its significance in the intricate network of signaling pathways within the body. (

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P22466 (A20-S123)

Gene ID
Molecular Construction
N-term
Galanin (A20-S123)
Accession # P22466
hFc
C-term
Synonyms
GAL; GAL1; Galanin prepropeptide; Galanin; GALN; GMAP
AA Sequence

ASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS

Molecular Weight

Approximately 43 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Galanin Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galanin Protein, Human (HEK293, Fc)
Cat. No.:
HY-P74132
Quantity:
MCE Japan Authorized Agent: