Galanin Protein, Human (HEK293, Fc)

Galanin exists as an endocrine hormone in the central and peripheral nervous systems and exerts its effects by binding to and activating G protein-coupled receptors (i.e., GALR1, GALR2, and GALR3). Galanin Protein, Human (HEK293, Fc) is the recombinant human-derived Galanin protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Galanin Protein, Human (HEK293, Fc) is 104 a.a., with molecular weight of ~43 kDa.

Galanin is a neuropeptide acting as an endocrine hormone in both the central and peripheral nervous systems, engaging G protein-coupled receptors, specifically GALR1, GALR2, and GALR3. This small protein exerts regulatory control over a range of physiological functions, including the contraction of smooth muscles in the gastrointestinal and genitourinary tract, as well as the modulation of growth hormone and insulin release, and adrenal secretion. By binding to its specific receptors, galanin plays a multifaceted role in coordinating various physiological processes, highlighting its significance in the intricate network of signaling pathways within the body. (

Human

HEK293

C-hFc

P22466 (A20-S123)

51083  [NCBI]

ASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS

Approximately 43 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.