1. Recombinant Proteins
  2. Others
  3. Galectin-3/LGALS3 Protein, Mouse

Galectin-3 (LGALS3) is involved in multiple activities, including IgE binding and signaling receptor binding. It negatively regulates T-cell receptor signaling and modulates immune responses by modulating endocytosis and lymphocyte activation. Galectin-3/LGALS3 Protein, Mouse is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Galectin-3 (LGALS3) is involved in multiple activities, including IgE binding and signaling receptor binding. It negatively regulates T-cell receptor signaling and modulates immune responses by modulating endocytosis and lymphocyte activation. Galectin-3/LGALS3 Protein, Mouse is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by E. coli , with tag free.

Background

Galectin-3 (LGALS3) is a multifunctional protein predicted to engage in diverse activities, including IgE binding, advanced glycation end-product receptor activity, and signaling receptor binding. Its involvement in negative regulation of the T cell receptor signaling pathway, endocytosis, and lymphocyte activation underscores its crucial role in modulating immune responses. Positioned in various cellular components, including the external side of the plasma membrane, glial cell projections, and immunological synapses, Galectin-3 operates upstream of processes such as extracellular matrix organization and skeletal system development. Widely expressed in anatomical structures like the alimentary and genitourinary systems, respiratory system, skeleton, and skin, Galectin-3 holds significance in diverse physiological contexts. Notably, it exhibits biased expression in specific tissues, such as the colon and duodenum, suggesting a specialized role in these anatomical regions. Studies on this protein may provide insights into its implications in conditions like asthma and fatty liver disease.

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of CTLL-2 cells. The ED50 for this effect is 1.370 μg/mL, corresponding to a specific activity is 729.927 units/mg.

  • Measured by the ability of the immobilized protein to support the adhesion of CTLL-2 cells. The ED50 for this effect is 1.370 μg/mL, corresponding to a specific activity is 729.927 units/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

NP_034835.1 (A2-I264)

Gene ID
Molecular Construction
N-term
LGALS3 (A2-I264)
Accession # NP_034835
C-term
Synonyms
GBP; L-34; gal3; Mac-2; galectin-3; 35 kDa lectin; CBP 35; L-34 gActoside-binding lectin; carbohydrate-binding protein 35; gal-3; gActose-specific lectin 3; igE-binding protein; laminin-binding protein; lectin L-29; mac-2 antigen
AA Sequence

ADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAM

Molecular Weight

Approximately 30 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Galectin-3/LGALS3 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galectin-3/LGALS3 Protein, Mouse
Cat. No.:
HY-P79079
Quantity:
MCE Japan Authorized Agent: