Galectin-3/LGALS3 Protein, Mouse

Galectin-3 (LGALS3) is involved in multiple activities, including IgE binding and signaling receptor binding. It negatively regulates T-cell receptor signaling and modulates immune responses by modulating endocytosis and lymphocyte activation. Galectin-3/LGALS3 Protein, Mouse is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by E. coli , with tag free.

Galectin-3 (LGALS3) is a multifunctional protein predicted to engage in diverse activities, including IgE binding, advanced glycation end-product receptor activity, and signaling receptor binding. Its involvement in negative regulation of the T cell receptor signaling pathway, endocytosis, and lymphocyte activation underscores its crucial role in modulating immune responses. Positioned in various cellular components, including the external side of the plasma membrane, glial cell projections, and immunological synapses, Galectin-3 operates upstream of processes such as extracellular matrix organization and skeletal system development. Widely expressed in anatomical structures like the alimentary and genitourinary systems, respiratory system, skeleton, and skin, Galectin-3 holds significance in diverse physiological contexts. Notably, it exhibits biased expression in specific tissues, such as the colon and duodenum, suggesting a specialized role in these anatomical regions. Studies on this protein may provide insights into its implications in conditions like asthma and fatty liver disease.

Measured by the ability of the immobilized protein to support the adhesion of CTLL-2 cells. The ED₅₀ for this effect is 1.370 μg/mL, corresponding to a specific activity is 729.927 units/mg.

• 
  Measured by the ability of the immobilized protein to support the adhesion of CTLL-2 cells. The ED₅₀ for this effect is 1.370 μg/mL, corresponding to a specific activity is 729.927 units/mg.

Mouse

E. coli

Tag Free

NP_034835.1 (A2-I264)

16854  [NCBI]

ADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAM

Approximately 30 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.