Galectin-4/LGALS4 Protein, Human (His)

Galectin-4/LGALS4 is a lactose-binding galectin protein with affinity for a variety of sugars. It is associated with the formation of adherens junctions, suggesting its potential role in cell adhesion processes. Galectin-4/LGALS4 Protein, Human (His) is the recombinant human-derived Galectin-4/LGALS4 protein, expressed by E. coli , with C-6*His labeled tag. The total length of Galectin-4/LGALS4 Protein, Human (His) is 323 a.a., with molecular weight of 35-38 kDa.

Galectin-4/LGALS4 is a lactose-binding galectin protein that exhibits an affinity for a variety of sugars. It has been implicated in the formation of adherens junctions, indicating its potential role in cellular adhesion processes. Notably, this protein functions as a monomer, emphasizing its independent molecular state and suggesting that it may exert its biological effects through individual interactions rather than as part of a larger complex.

Human

E. coli

C-6*His

P56470 (M1-I323)

3960  [NCBI]

MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI

35-38 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 5 mM EDTA, 2 mM TCEP, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.