Galectin-8/LGALS8 Protein, Human (GST)

Galectin-8/LGALS8 protein is an important enzyme in the glycosylation process, acting as β-1,3-N-acetylglucosaminyltransferase to synthesize poly-N-acetyllactosamine. Galectin-8/LGALS8 is essential for modifying glycoproteins and glycolipids, catalyzes the transfer of N-acetylglucosamine to acceptor molecules, and exhibits specific activity on type 2 oligosaccharides. Galectin-8/LGALS8 Protein, Human (GST) is the recombinant human-derived Galectin-8/LGALS8 protein, expressed by E. coli , with N-GST labeled tag.

B3GNT4, a key enzyme in glycosylation processes, functions as a beta-1,3-N-acetylglucosaminyltransferase responsible for synthesizing poly-N-acetyllactosamine. This enzyme plays a crucial role in the modification of glycoproteins and glycolipids by catalyzing the transfer of N-acetylglucosamine residues onto acceptor molecules. Notably, B3GNT4 exhibits specific activity for type 2 oligosaccharides, contributing to the diversification and complexity of glycan structures. The synthesis of poly-N-acetyllactosamine by B3GNT4 underscores its significance in modulating cellular interactions, as alterations in glycan structures can impact various biological processes, including cell adhesion, signaling, and recognition events.

Human

E. coli

N-GST

O00214-1 (M1-W317)

3964  [NCBI]

MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW

62.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.