1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GALNT10 Protein, Human (HEK293, His)

GALNT10 protein assumes a crucial role in the initiation of O-linked oligosaccharide biosynthesis, facilitating the transfer of an N-acetyl-D-galactosamine residue to specific serine or threonine residues on protein receptors. With its catalytic activity, GALNT10 demonstrates specificity towards substrates such as Muc5Ac and EA2 peptides, contributing to the intricate process of protein glycosylation and subsequent cellular functions. GALNT10 Protein, Human (HEK293, His) is the recombinant human-derived GALNT10 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GALNT10 protein assumes a crucial role in the initiation of O-linked oligosaccharide biosynthesis, facilitating the transfer of an N-acetyl-D-galactosamine residue to specific serine or threonine residues on protein receptors. With its catalytic activity, GALNT10 demonstrates specificity towards substrates such as Muc5Ac and EA2 peptides, contributing to the intricate process of protein glycosylation and subsequent cellular functions. GALNT10 Protein, Human (HEK293, His) is the recombinant human-derived GALNT10 protein, expressed by HEK293 , with N-His labeled tag.

Background

GALNT10, a member of the GALNT (N-acetylgalactosaminyltransferase) family, serves a pivotal role in the initiation of O-linked oligosaccharide biosynthesis. This enzyme catalyzes the transfer of an N-acetyl-D-galactosamine (GalNAc) residue to a serine or threonine residue on the protein receptor, marking the initial step in the glycosylation of proteins. GALNT10 exhibits its glycosyltransferase activity towards specific substrates such as Muc5Ac and EA2 peptide. Through this process, GALNT10 contributes to the diversification and modification of proteins by adding sugar moieties, thereby impacting various cellular functions and processes. The enzyme's specificity for certain substrates underscores its role in regulating glycosylation patterns in biological systems.

Biological Activity

Measured by its ability to transfer GalNAc from UDP-GalNAc to peptide MUC5AC-3/13 that incubate at 37°C for 20 min. The specific activity is 688.65 pmol/min/μg.

Species

Human

Source

HEK293

Tag

N-10*His

Accession

Q86SR1-1/NP_938080.1 (T39-N603)

Gene ID
Molecular Construction
N-term
His
GALNT10 (T39-N603)
Accession # Q86SR1-1/NP_938080.1
C-term
Synonyms
Polypeptide N-acetylgalactosaminyltransferase 10; GalNAc-T10
AA Sequence

TPGGSGAAVAPAAGQGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN

Molecular Weight

Approximately 70-75 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GALNT10 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GALNT10 Protein, Human (HEK293, His)
Cat. No.:
HY-P76354
Quantity:
MCE Japan Authorized Agent: